00       00

Click here to search
Bug Report
Report an error

P.abies 1.0 gene MA_93206g0010
Page views 34


Chromosome Start End Confidence Trinity id Subject length Subject coverage Subject strand Query strand
Loading data from server


Gene Description based on Blast2GO: Soluble inorganic pyrophosphatase 4

Populus Transcript name:     Potri.006G082500.1
Arabidopsis id:     AT1G01050.1

Map Image: 


GO ID Name Space Description
GO:0000287molecular_functionmagnesium ion binding
GO:0005737cellular_componentcytoplasm
GO:0006796biological_processphosphate metabolic process
GO:0004427molecular_functioninorganic diphosphatase activity

PFAM ID Description
PF00719Inorganic pyrophosphatase

CDS Sequence
Legend:   CDS        START        STOP                         

>MA_93206g0010[819 nucleotides] 
ATGGCTACCTGTTCCGTCATTGGGAGTTCTAGGCGCGGGAACTGCCCAAGCACAACACAGCATCACTACTCCCAGAGGCTCTGTATCTGGTTCCGAGCTTCTAGAATTCGGGGCTTTGGTGGCCGATACACCAGTCAAGCAAAGACACTTTTTTCACAATATTCAAACATGACTCCACCTAGTGCTGAAGGTCCAAGAAATGGAGGAGAATCACGCTTTCCTCATCCACCTCTCAATGAAAGAATACTTTCATCTCTGTCACGTAGATCTGTTGCTGCACATCCTTGGCATGATCTTGAGATTGGACCTGGAGCTCCTTCAGTGTTCAATTGTGTTGTGGAAATTGGGAAAGGAAGTAAGGTGAAGTATGAACTGGACAAGAAAACTGGTCTGATCAAGGTAGATCGAATTTTGTACTCATCAGTAGTCTATCCTCATAATTATGGTTTCATTCCACGTACCCTGTGCGAGGATAATGATCCATTGGATGTGCTGGTCCTCATGCAGGAACCTATTTATCCTGGATGCTTTCTCCGGGCTAGAGCCATTGGTGTGATGCCTATGATTGATCAGGGAGAAAAGGATGATAAGATCATTGCTGTGTGCGCTGATGACCCTGAGTACCGCCATTACACTGATATTAAGGAGCTTCCTCCACATCGTTTAGCAGAAATTCGACGCTTCTTTGAGGATTACAAGAAAAATGAGAACAAAGAAGTTGCTGTGAATGATTTCCTTCCTGCATCTACTGCTTGTGAAGTTATCCAACACTCAATGGACTTGTATGCTACATACATCGTTGAAAGCCTACGACGATGA
   



Genomic Sequence (+ strand)     upstream:    downstream:   
Legend:   CDS                         

>MA_93206:20885-31175[10291 nucleotides] 
ATGGCTACCTGTTCCGTCATTGGGAGTTCTAGGTTGGGACCCCGCACCCTAAGATGCGATAACCCTCACCCTTAAATGAAGTTAGAGATAAGCGTGCTTGCGTTGGACGACATTTCACTACATGAAAAGTAGGGAAGCCTTATTAGAACCATATTTTTTCACTCATTGCTTAGTTTTTGGTTTTCTTTAGATCACTGGAAAGATAGCTTTTCCCCGAACCTTGATGTTTTTCATAAGGCATCAAAATCACGAAAAAAACATAGGAAGTCTTAAAAATGCATCGAAGGTTTAACTCCTAAAAATTATTAGAATTATAAATGTTTTGAGATGACCTACAGGGGCCACTTGGATTAGAGAGATTGCCTCTTAAGGGATAAATCACTGGCCCCTTAAAACCATGGACCATTTCATAACACAAAATCCCCATCTTCTTTCATATGAAAGCATTAACCAAAATAACCCTCACCACCAAAGTAACATTGCATTCCAAATTTCAAATGGGGAGCTCACTGCCTATGAATCTAAACATCTAGGGTTTTGTGATTCCTGTGATGCCATACACTTTCCCATCGAACCTTGATTAGCGCACAACATAGTTTTTCGCTTTGGGCCTCTAAATGGGATTCCCATCTTGGGGATCTCTTTCAACACATGGAAGATGGATTTGAAGACTCAACTCTTTTGGTAGAGGCGATGGCTAGCACGCTTAAAGCCATGGAATTTGTGTCAAAAGAGGAAAGGGAGCCGACCTCATGCACACCGACACATGCCGTTCCTCACGTCAACAATAGAGCATGTTGCAAGTCACTTGGGAACATAATGATGTTGCAATAAGATCTTCTCTACAAGAGCACAACAACAAGAAGCTATCTAATCATGTAGCAAACTCCCCCCGAATGGTTGGAGTCCAACAAAAAAAAAAAAGTTGAAGTTCTAATGGCTCTGAGACTCTCATCGATTTTTTTGATGATTTAAGTCCATTCAAAATTAAACAAAACCTTTAAACACATCGCTACACCATACATAAAACTTGAATCAGTATTCACACTTAAATTTTTGTCATTTTTTAACAAGTTCATAAAATTATTAAAGAAACCCTTGTCTCCCTCACCTACCAAATTAAACAAACCCTAATTTCCAAACATAAGTTTGTCTCCCTTACCTTAACGAAAATACCACACCAAGGCATATTCCTTCGACGGAGGATGACATGACTCCGCACCCGCCCACCCTTATAGACGATTTCCCTTGATGCTCACTTGTGGCCGAAATAAAATAAAATAAAGCGAAACCGCATCGAGTGAACGTGAAATACACGTCAAACGAACATGCACGATCTAACTTGACCCGTCGCCTTTCCTCCTCCGACGGAAGACACAGAAGAAGTATGAAAGAGCGGAAATCCACTCAACTATAGTTGGCACCCACTGCGGGGAATCGGGGATTCCTCCTCAACCGTCGGATCAAGATCGCACGCACCCTGTGCGCAACGAAGACCGTTAGGAATCCCGTCCCAATCGTGTCCGGCCCCGGGTGATGAGTCACCTCGTTGGATCCTTGAGACCTCCGCGTTTCGAACCCCACACCCCACGCTCCGTCCCCACTCACACAAGTGAATTGAACTGGACGGACGGACGTCGAGAATCACAGAATGATACCCTCGCTGATTCCTTTATCCGCGCTCTCCCATCATTCCCGTTGCTTAAGTCAGACGCCTTCCCTCCTATAAACGTACAGGCGCGGGAACTGCCCAAGCACAACACAGCATCACTACTCCCAGAGGCTCTGTATCTGGTTCCGAGCTTCTAGAATTCGGGGCTTTGGTGGCCGATACACCAGGTATGTGCATGCTCTGTTTTCATTTTTCTGTTCTTTATTTAATGCCCATCTCTTTTTGTCCGGCCGAGGAATTTAAATCTCATAACTGTTGCGGGGGCGCTTGCTGCGGGATCCAGTGTTAAGATATTTGTCCGGGATCGGTTTCCCGGCCGAGATTTATCTTAGCATAGCGCGGCGGACCTGTGTTGGAAACCCTAGCCTGTTAAATTTTTGAAGTCTGATCTGTTTTGTTTCGGATGGTGGATCTTACATGCAAGATGTTATCTTAGGACTCTTATGATCTTTGTGAGTTCTATTTTTTTGTTGTTGTTTCCGAGCTTTGTGTCGAGAGGGCTTTTATTTAATTTTTTTTTTGTTGCTATGAAGTCAGCTTACTGTTACGGGACAATCTGTGTTGTAAATCTCATGAGGACTTCGTTATGGGGAATTTCGGTATATATTTAGTCTAAGATTGTGTTGTGTTTGGGAAGATAGCAGTGTGTTTGTCTGATTCGATAAGGTTGTGTAAGACGTTCGCATGAACAAGGTGCAGATGTCCCTTCTGTCGTGATTCGGTGTATACAGTGTGTATACGTCTGTCCATTTTATGTGGCGCAGAGGAATGGATGTATGCGCATCGTTTAATGTTGTTGTCTGATTCGACGAGGTTTTGTGAAGAATTTATGTGGAAACAAGGTGCACACGCCCTTTCTATCAGGATTCAGTATATACACAATGTGTATACGTCCGTCCATTTTATCTTGTGCTGAGGAGTGTATGTATGCACATGGTGTGTATACATCCTTATTTTAATGTCGCACTGTTATTCATGTATACATGCTGTACATATACCATTGTTTACATCCACATCCAGCATGGAACTATTGGACATCTATTCTGTTTAGGAGTTGGAGCATACACAACACACATACATATCTTTCCAGGTAGGCTTTATATACTGTCAGAGTCTCTTCATACAAATGCCTGTGCCATTGCTTTATTGAATCTCGCAAGGGATGATGATCAATGATCTTTCTACAGATCTAAGGCTACCAGCTTTTCCAAACATTTTGGAGGTGCTACAAATCTAATTCATGACACACTATATATTCATATCAATGATTTTGCTACAATTCTAAGGCTTCCAGCATTTCCAAACACTTTTGATTCTGCTACAATTTTAATTCATCTATACACACTGTATATACACCATCTTTTATATCCAACAGGTAAATAGGTATACTCAACTGTTATACATCCATTCTGTTTAGGAGATGGAGCATGCACAACACACAGACACCTATTTCTAGTCAGTTCTTTTCTAATGCCAGGGTCTCTTCATACAAATGCCCGTGCCACTGCTTTATCAAGATTCGCAAGGGAGGATGTTGAATGTCTTTGCTACAAATCTAAGGTTGCCAGTATTTTCAAACATTTTGGAGGGGCTTGTGACCAGAGGACGTGTTCTAAGCCTTGTCCTGGCCTTTTAAGCTCGTTAACCTTAATAACAGAACATTGAATATCTCGGGATTTGCTTACCATGAAATGGGTAAGCTGTTATTGCCGGTTGACCTTATTAATGTTGAAGAGCCACATAGGCAGCAGGGTAGCAGATTTATGCATAATGGCAGATGGTTTATACATCCTGTTTATTGAAGTAGTTGCTTCAGTGGAACTTGCTCTCTATGCACTGTTGCAGCTTCTCTTGTTCCAATTTCTAGCAAATCAATTGTTGGTATTTTCTAAGTCATTTTCCATGTAAGGAAATAATCTGCAGACTGCCATTTTTCAATTTTAAGATTCAAATCATGAGGATTCTGGAACGTTTCTTAGAATTCCCTGTGAGATTTGTAAAGCTGGACTCGGGAGTTTTAGGAAACAGAGCGTGGTGCAGGAGAATGAGCCCAATGAGTCTTCTGCAGAAGAATGAAGGGTAGCACAGTCAGGGCACAGTATGTCCAGTCGCAGTGCATTGGAGACAGGCTTGTCAGGAGCAGACATTCGCTGTGCAGTCAGTCCAGTCATGGTGCAGTGGAGAACAATTTTAACATCACGATAAAATTGCTTAATAATGGTGATTTAATTTTTTCTGATTTGATTCAGTGATTAGTTTGCCGAACATGGCAAACTTGATCGCAATTAGTTTGATAGTTGAAAAATAGTCGTCGCTTTAGTCCCAATTATCTATAGTATACCCGTTTCCATGTATGACACTGACACGGATCATTTGTTCACTTGTAGCAACTGCTTTCCTCCAGATTTAGATCTTACTTTCAAAATTCTGTTTGTGGCTAGACAAGGATCTCGTTTTCAGAATTCTATCTATCGTGCCACGAAGGGTGAGGTCACTTTGGTTTGAATATATGGTTAAAACATTCGGTTGGCAGATGTTTGCTGAGAGCTTTTTATTCTGCTCCTAACAATATCTAAAGCAAGTTGCCAGGTTTTTATTTACCATGGATCGTGGGTTTAATTTCCACTGAATTCATTCCATGTGTATACAATGTAGGCCTTGCCACCTAAAGTGGGTATGGTTATGTGAAACCATGATCCCAATCACCATGAAAGTAATGCCTACTGTGGCTTTTTTCATAGTGATTATGGCGTCTACTTAGCTTGTGTGTGATTAAGTTCCAGATGCACCTGATTGCTCTAAACTGTTTGTTGCCCATTTTTTTATGAAACNNNNNNGATTGCTCTAAACTGTTTGTTGCCCATTTTTTTATGAAACCCTGGTTGTTCAGAACTAAGTGCACATTAAAGTTTCTGTGTGCTTCATTCTCGACTTTTGCACATCAAAATCCTTAAATTATCCTGTCTGATTTTCTGGTCTTGCGACTATTATATGTGCTGCAAAAATCAGACTCAAGAATTACTCTCAGATGGCAGGGGTCAAAAAAATGGACCAGGGGAGAAACTCAGGAGAAACCTGGAATGGTTCATGCCTTTTGTCCCATTTTATGGACTAGCCAATATTATATGTGTTGCAAAAATCAGACTTGGGTATTAACTTAGCTGGGAGAAACTCAGGAAAAAGCCGGAATGGTTAAATAAAAAGTTTACAAGCATTAAAAATGCAAAATATTTAATTTTTTTTTCAATTAAACTATATCATAAACTTTTTTGGTTTTATAAGAGTATTTTTGAATGAATTGCATTTATTCTGATTTCTCTTTTGAGGTTTTATAATCAGCAGTTTTTAGCAACAGATGTATTTTCTTCCAAGTCATTTTTATCTAAAAGCAAGCGATACATGATTGGATAAATTGTGTTAGGTACCAATATCTGTTGTTTCTTTTGATCGCTTTCTTTTCTCTGCAATTTTTAGTATTTTACAATGTTTCACATTATAAAATTGCACCTGTGGTACAACTAAAAAAGGCTTCACATGTTAGATTATGCCAGTGTTTTCTCATTAGCAGTTTTGTAAATGGCAAAATCCTTAACATTTGTGATTTTTATTATGAGATTGGAATTCTGGATGGTGAAATGAAAAAGTCAACCTCTCTGGCCTATGTACCTGTTTTTCAGTTGGCTCTGTTTTTACCCATCAATGTCTTATAATTTTTCCAGGTGGCTCTGTTTTTATTCATCAATGTCTTATAATTTTTCCAGTTGGCTCTGTTTTTACTCATCAATGTCTTATGCTTGGTCCAGTTATTTTTCGGTTTCTTTCTTATATGTCTTTAAAACATTTTCTTCGATTTTTCTCTCATATACTATATATAATAACAGGGAGATTTGTCACGGTGCATTGCAGTCAAGCAAAGACACTTTTTTCACAATATTCAAACATGACTCCACCTAGTGCTGAAGGTCCAAGAAATGGAGGAGAATCACGCTTTCCTCATCCACCTCTCAATGAAAGAATACTTTCATCTCTGTCACGTAGATCTGTTGCTGCACATCCTTGGCATGATCTTGAGATTGGTAAGTGCTAAGAACCCTTATTTTCTCATTTTTATTCTGTTGATAATGACCATGATCTGGTGTCATTTGTCACTTTATGGCAATGTAAACATCACTCTGGATATTCATGCATGTAGAGATGTATTACATAAACACAGGATCATTCATGTAGCATTCAACTGTAGGGGATGCTTGCGCACGCATAACAAGAGTACATTGATAATGCATTATTTTGATCGTCTGGAGGTGTCTGCAATAGTTTACCTCAGGTTGTGAATAAAAGGATAAAAACATTGGTTATGTGTGAAGGCCTTTATGTATCTGAAACCGCCCTTTCAGCAGTGAATGCTGATATCATGATGAATGTATTCCACACTTGACTGGCTTGTCAGCGACAGATTGCATTATAATAATGTCATAATTGTCCATATAATTTTGTAATAATTAGTCGCTTAGATTGTTTCTTTGGTTTTTATGTTGGGATGGTTGATATAAATATGGACTTCAATCTTTGGCTGCAGGACCTGGAGCTCCTTCAGTGTTCAATTGTGTAAGTACTTGGTAGCACTCTTTGATAACTAGATGATGTTCTAAATTACTTTGAAGAATATGATAAGGCCTAAGTACATCATTGGTGCTGTTATTTTTTATTTACTCACTAGAGCTTGCTTTTAGGATGTAACACTTCCAATGTTTGTATATTTGACAAATTCTGCATCCTTGAAAATATGATTGCAATTTGCCTCCTGTCTCTCAACTGCACACTCAGACATGAGATGGGAATGTTTTTATAAACATGATGGAACATGTAATCGGCTCCTTACTATTACTCATAGTAAAAGGTTTGAGCTTCCAGGCACACGTGGGGAAGAGTGGTTCCATTACATGTGGTTAATATTTACCTCTCAGAGAGGATGGTTTAGTTTTCTAAATAGGAAAAATCCGATAGGCTACTTGAGAGGCACATGGCATTCAAATAATAGAAACCCATGCTGTCATTTTACCACATTTGAATAAACCTCCTATCACTTATTACCACATTTGAATAATCTCATATCACTTATCCTTGATTTGTCCATTTCGACCACCTGGTTCTTGTCAATCCACCTATAATCATGCACCTATCTATGTTTTGATCTTGTAAGATGAGATCAAAAACTGATTTGTATTTGTTCAGTGAATCATCTTGTTTAGCTTTTCAACACATTTACATCTGCTATGAGCTTTATGGCGGAGTCATGTTGGCACCTACTTTAGCTCATCCACAACTTCTGAGTGCTTTAGTTAGGAGCCATTACTCACTCTGATGCTGCTATAGTTGCTGTTTTAGTGCTTTGTTCATTGCAATTACATGAGGACCTTTCTTCTGGGTAAACAGTGAAGTTTTTCTAAATATTTTCTTCTTCACACAATAGAGTATCATGGTTTTCTATTTTCATGTAGAAATTATGAATTCTATGACATAACTTCATCTTACACAGATAAAAGATGGCTGGCCATCACATTAGTTGGCCTCCTTGGATATGCGTATGTCATTGAGCCTTTTGTCGGGAGATGCAGCTTTTTGTTATTAAAATTGTATCTGGGATGAGCATTTTGATATCTCGTTATATTTTTGCTCTCAATAATGTGCCCAAAAGTATGCCCTTCATATCTCTGTCCCTGAAATGATACTTTGTTTTTATGCTTACTATTGCTGGTACTTTCTTCACAAAGTACCAAAAGTTAGCTTCAAACAAGCTCAAAATACTTGCTTACATCGCGATGCATTTTCTCTCAAAAAAAATTACAGCAGAGAAGGCATCTGTCTGTTATCACTCTGTGCTTCTTATTTCTTGCCCACCGTGTTTTCATTGCTAAGCTTGATAGAATATCGTTTCTGATTTCCTAGACAACGAGTTTATTGTAGGTATGGACAGGTATCACTGTTATCTCTTGCATCATTGAGATTGGAAATTATATTTCGCTTAAGGATTCCAATATCCATCCTTAACTGTTTCCAGATTACAAGGATCACAACGAGGCATGATCATATATACAATTATCCAGTCGATGATTCAATTTCTCTTCCGCTTGATCATATATACAATTATCCAGTCGATGATTCAATTTCTCTTCCGCTTATCATTTTTGCACGTTGCACATGTCTGTTTTCTAAAAATTAATTCTTAAGCTTTCCACTTTGAGCACAGTTGCTACATGTAAGTATTGAAGTTTGACATTCTTTGCACAGTGCGTTGACCTGCAATGTTTTTAATCAGTGATTAAAAATCTGTCATCCTTTATTGAGGAGGCTAAAATGTTTGTTTTGACACTTAAGGTTGTGGAAATTGGGAAAGGAAGTAAGGTGAAGTATGAACTGGACAAGAAAACTGGTCTGATCAAGGTAAGGTTTATTTATTTTGAGCCTTTGAAAGTTATATTTCTAATGAAGTGCACTTTTTGTAAGTGTTGGGTACCATATTTTAGGTTAATCTTTAATTTCACGATTTCATTTTGTAATGTATAAATCCAGGTAGATCGAATTTTGTACTCATCAGTAGTTTACCCCCATATGCAGGTAGATCGAATTTTGTACTCATCAGTAGTCTATCCTCATAATTATGGTTTCATTCCACGTACCCTGTGCGAGGATAATGATCCATTGGATGTGCTGGTCCTCATGCAGGTAGTATCCCTCCATAAATTTATGATTATTGTCGGTTCCGCATCTCCTGTATATATTCTCATGTATTTCCAGAGTGCAATAGGTTGTCTATGCCGGTTCAATTTTAAAGATTGCTTTGGAAGCTCTCAATTGCTATAGGTTTAGTTTGAAGTATAATTTGATTGCCCCTCAATGCCTCGGACATTTTCAACCAACTCTTTTCTGTGTGTGTGTTATGCATATCTTGTTATGCTTTTACAAGTGAGTGCAGTCTTGTTCATCGAGGATAAGCTATCCTTTGGATGTTTGGTGAATGTTTCTTATTAAGAGGATGCTATGCTTTTTGGAAAATTTGCAGGAACCTATTTATCCTGGATGCTTTCTCCGGGCTAGAGCCATTGGTGTGATGCCTATGATTGATCAGGTGTGTACAAGTTACTCTGCTTATAACCCAATTCTCGTGGAGGTTGAAATCTAACAGATGCTTTGAAACGAAGTACCTTAATTCTTCCATTATATTAATGTGTACAGTGAATTATTGCAGTGTCTATTTTTTTGGAAAGGGAGAACATGCTGAAGCCTTTATAAATCTTTCAAATTAATAATAATAATGATCTAATTTTATGGTCACAGCCAAGCCAGACACCAAATTGGTGTATGAGCCCCCTTGTTTGTGGGACAAGGGACCCCTTTGGATTTGAACCTGTGACCTATTAGGAAGAAACACATGTTCTTAAGCATTAGGCCCACTAATCATGGAAGCAGTCAACAGCCAAGCCAGACACCAAATTGGTGTATGAGCCCCCTTGTTTGTGGGACAAGGGACCCCTTTGGATTTGAACCTGTGACCTATTAGGAAGAAACACATGTTCTTAAGCATTAGGCCCACTAATCATGGAAGCAGTCAAACATCCTCTTGTTTAAACTTTGTTTAAACTTTATATTACCAGCATTATTGTGCATTTTCAAGTGTGACAAATGACTAGTGTTGTCTTATAACACAATTGGTTGAGTCAAATAATGATCTCTCATATTATTGGGCTTTGTCTTTCCATTTGCCTAAGCTTACTCTTGATGTTTCATTCTCAAATGAGAAACTAACATAGGAGACGGAAAGGATCTTAACATGCCCATTGGTACTGTAACTTTGAATTTTCCTTGAGAAGCTAATCCAATCTATTGAATAAAGTTAGATCCTACAAGTTGTGTCATTGCTTGAAAAGTTATAAAGCTGAAACTGTTTGATTTCTTCCCATTTTAAAGATGGATTAAAGGCTTTTTCAAATCTGTTGAATTAATCACTTAATGGTTGTTGGATTCTTTTCTATCTTTTCGCATACACTCTTCCCAAAGGGTGCATTTGCACAGTAATATTTAGGTTCCATTTCTATGACAGGGAGAAAAGGATGATAAGATCATTGCTGTGTGCGCTGATGACCCTGAGTACCGCCATTACACTGATATTAAGGAGCTTCCTCCACATCGTTTAGCAGAAATTCGACGCTTCTTTGAGGATTGTATCCTTTTGCATTTAAATTTCAACATGTCTAGCCTGTCTCTTTTTTCCTCCTAGAGATCAATCACGGTATTTGTCGGTTCTGTTTTGAGTTCCATGTTATAGGTCTCGTTTGATCCGCTTCGTCAGGCCTTTATACCTTCCAGCGTAGGTGTTTTTTTCCTTGACAGCATCCAGACAAGAAAAATGAGAACAAAGAAGTTGCTGTGAATGATTTCCTTCCTGCATCTACTGCTTGTGAAGTTATCCAACACTCAATGTAAGCAAGCTTCATACTGTATTGGTTTTGGTACTCAAGAATATGCTATATTGGCGAATAGGCGAGATTTAAACCCTTACATGTGTCTTATCTTTACAGGGACTTGTATGCTACATACATCGTTGAAAGCCTACGACGATGA
   



Peptide Sequence
>MA_93206p0010[272 residues] 
MATCSVIGSSRRGNCPSTTQHHYSQRLCIWFRASRIRGFGGRYTSQAKTLFSQYSNMTPPSAEGPRNGGESRFPHPPLNERILSSLSRRSVAAHPWHDLEIGPGAPSVFNCVVEIGKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPIYPGCFLRARAIGVMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASTACEVIQHSMDLYATYIVESLRR*
   



PlantGenIE GeneLists

Gene Family Genes
Amborella trichopodascaffold00011.104; scaffold00102.2; scaffold00064.86; scaffold00168.9;
Arabidopsis thalianaAT1G01050; AT3G53620; AT2G46860; AT4G01480; AT2G18230;
Oryza sativa ssp. japonicaOS02G47600; OS05G02310; OS01G74350; OS04G59040; OS05G36260; OS10G26600; OS01G64670; OS01G21900;
Physcomitrella patensPP00142G00850; PP00315G00330; PP00552G00010; PP00046G00280; PP00235G00460;
Picea abiesMA_93206g0010; MA_9114055g0010;
Pinus taedaPITA_000003930-RA; PITA_000005911-RA; PITA_000019115-RA; PITA_000053626-RA;
Populus trichocarpaPotri.007G022700; Potri.006G082500; Potri.002G181300; Potri.014G107100;
Vitis viniferaVV04G01910; VV08G02380; VV15G07600; VV02G06000;
Zea maysZM06G04810; ZM05G37890; ZM08G15060; ZM10G27000; ZM05G11350; ZM02G08930; ZM06G04800;

Map Image: 


Login | © 2019 PlantGenIE.org.| All our tools are under MIT License

  • GeneList
      view active genelist () here.
      genelist namegenesrename/delete
      add new genelist / save current list / cancel
  • Analysis
  • <