00       00

Click here to search
Bug Report
Report an error

P.abies 1.0 gene MA_156299g0010
Page views 32


Chromosome Start End Confidence Trinity id Subject length Subject coverage Subject strand Query strand
Loading data from server


Gene Description based on Blast2GO: Type alpha 5


Map Image: 


Gene Ontology values could not be found for MA_156299g0010 gene.


PFAM ID Description
PF01453D-mannose binding lectin

CDS Sequence
Legend:   CDS        STOP                         

>MA_156299g0010[622 nucleotides] 
TTTCCGTCAAAGGCAGCAAGTGCCATTACTAGCTACTGCCATTTTCCAGGTTGTAGGCTCGCCTCCTTTGTGGAAGGATTCACGGAAATGGAAATGGGAAGAGGAGAAGACGAATGCGGTCGTTGGAGGGCTGGGTATCGACTTCTATTACGTCGACATCATCAATATTGTGGCTCGACAGAGTGTGTGCGAATCCCCCTACGAGCCCATAATGACTACCAATCCTTTCATTGTGTTGCTTTCTGATAATGGTTTGGAGATCATGGATGGCAACAACGAGGACGTCTGGAACAACAACACATCGAATAATTACCAGTCATTGGTTCTGCGGGAAAACGGAGCTCTCCAATTGGTGGACAAGAAACGACAGACTGTCTGGTCCTCCACCGATCATCCGCGGGTGAATCAAAACTGGGGCACCGTTCTCCAACCAGGATCCTCTCCTTTCATTAATCCTCCATTCGCTTCCCCACTGCAGGCTCAACTTCCCAACGGTCAGCCAGTCTTCTTGCATCCTTTCACTACCGCTAATCCCATCATGGGTAGTGCTCCTCCACAAATAATTCATCCATATTACCAGGTTGTTGTTGGATGTCTCATCGCCATCTTCTTCCATCCTTAG
   



Genomic Sequence (+ strand)     upstream:    downstream:   
Legend:   CDS                         

>MA_156299:1-2418[2418 nucleotides] 
TTCCGATCTCACTATATATATTTCCAAGAATATGTAACACGTTTTTTTATTTTTTTATATATATGTCATAAATTGTGTTCAATACTTCTTTTCTACTCACACATATAGAGAGTATGTCATTTCTTGTATCCTTACCACCTGTATTTCATATTGCTTTCCACATCTACACTGTAATTTCAAGGCCCAAGTCCAATTGTGTTATTACATCAACACGAGGGTCTTAAAATTCAAATAGTTTGCAAGTCCGCTTGTCAATTTGTATATCGCAGAACTCTTGGTGCTATTTGTAGGACACAAAACAACAGAGCCCAAATTTTGAGCCCGCCAACCCGAGAACTCACGATCCAAAAAGTGCCTAAGTATGGAATGAGCACTCCATGCATGGTTGATAAAATCTAATGCCCATACTTTATAAAAGTACATATTTGGTATCTATAAAAGTAAATATGTACGTTATAAAAGTACATATTTCGTATGTATAATTTATGGTGTCCAAGAACCTATAATTTGATAAATTTCAATTTCTTTTGTGTCCAAGAGGCCTTGTTTTAAATAAAACTAATTCGGGAATGCTAATTTTTTTGTGTTTTTGTCCACGAACCTATGTAACATACGTTACTACTATTCTATTATATGCTAAATTTTTTGTGTCCAAGAACCTTTTAAATGTATTACTATTGTACACAAAAAAAAATTGTCCATGCTCCTTTTAAATCTTTAGTGTACTATCAAACTTAGATATTAGGAACCTTCGTTGATGTACCACACATATTAATAATTTTTTATAAATTTCAAATAAAACTAATTAGGGAATACTAAATTCTACATTGATACCACATGTATTGCAACTTGCAATGCAAGTGTCTTTACATGGTCGCATTTACTCCCATTCCAACCTGATAGGAATTAAGCTGCCATACAACACTTATTTTTAATATAAAAAAATCATAGTTAGATTCAATTTAATATAAATCTCAATACTATTTGATCACATAATCTCCATAGTGAACCTCATTTCTACCTTATCCATCGCAATGGATTAGATATTTAAGTGGAAATAAATATAAATATTGTACGTCTTCCCAATGGGATCTTTGATAATGATGATTGAAAACGAAAGATGACATAAGATTATATATTCTATTTAATTTACTTCTAATTAAAACCAACCACAAACTTTCTTTTAAATAAATAAATAAAAATGAGTCGAATTGATGAAGCCCAAACATAAAAAATGAATGGACTAGAGTTTGCAACTCTAACCAAATCAATGCCTACAAAACACACTCGAAGATTCGGTTCACCTGTTCACTCACCATCCATCTCACCATTGAATATATTTATTCCATTAGATGGCTTTCTTTTTCAATTAGCTCATTGTATTGGATCGGTTAGGTTAAAAATAATAAGAATAGCTCCAACAACTCCCCATTTCCATTCACATATTCATTTCAACCTCATATCCACATCTCTCGCTATATATGCATTTGTGTTAACAATTCATTGTCATCACAGTTTCCGTCAAAGGCAGCAAGTGCCATTACTAGCTACTGCCATTTTCCAGGTTGTAGGCTCGCCTCCTTTGTGGAAGGATTCACGGAAATGGAAATGGGAAGAGGAGGTACTAGTCATGGTATAAATTTTATTGTTGGAATGAAAATATTGTTAGTTTTATTGAGCGTAGGCCGGGGATTATTGATGTGTGAAGCTCAAGGTGTGGCAGCTGCGGGAAGTATTCGGCGAACCCAAATACACCAAGTGCTAGCGGCCCTCAACACTCCCTCTATAAACTCGGGAGTTGGCATCTCCACAACAGCAGGTCCTATGAGCACGCCATTAACAACAACGCAAGTGTTTATGACATCTCAGTCTGGCACTTTCAGTGCGATGCTCAAAAGATAGAAGACGAATGCGGTCGTTGGAGGGCTGGGTATCGACTTCTATTACGTCGACATCATCAATATTGTGGCTCGACAGAGTGTGTGCGAATCCCCCTACGAGCCCATAATGACTACCAATCCTTTCATTGTGTTGCTTTCTGATAATGGTTTGGAGATCATGGATGGCAACAACGAGGACGTCTGGAACAACAACACATCGAATAATTACCAGTCATTGGTTCTGCGGGAAAACGGAGCTCTCCAATTGGTGGACAAGAAACGACAGACTGTCTGGTCCTCCACCGATCATCCGCGGGTGAATCAAAACTGGGGCACCGTTCTCCAACCAGGATCCTCTCCTTTCATTAATCCTCCATTCGCTTCCCCACTGCAGGCTCAACTTCCCAACGGTCAGCCAGTCTTCTTGCATCCTTTCACTACCGCTAATCCCATCATGGGTAGTGCTCCTCCACAAATAATTCATCCATATTACCAGGTTGTTGTTGGATGTCTCATCGCCATCTTCTTCCATCCTTAG
   



Peptide Sequence
>MA_156299p0010[206 residues] 
FRQRQQVPLLATAIFQVVGSPPLWKDSRKWKWEEEKTNAVVGGLGIDFYYVDIINIVARQSVCESPYEPIMTTNPFIVLLSDNGLEIMDGNNEDVWNNNTSNNYQSLVLRENGALQLVDKKRQTVWSSTDHPRVNQNWGTVLQPGSSPFINPPFASPLQAQLPNGQPVFLHPFTTANPIMGSAPPQIIHPYYQVVVGCLIAIFFHP*
   



PlantGenIE GeneLists

Gene Family Genes
Amborella trichopodascaffold00041.152;
Picea abiesMA_36566g0010; MA_142765g0010; MA_156299g0030; MA_26909g0010; MA_5831221g0010; MA_156299g0010; MA_25658g0010; MA_9418976g0010; MA_1056310g0010; MA_142765g0020; MA_156299g0020;
Pinus taedaPITA_000010564-RA; PITA_000031311-RA; PITA_000009014-RA; PITA_000095178-RA; PITA_000065039-RA; PITA_000050620-RA; PITA_000050619-RA; PITA_000050621-RA; PITA_000095433-RA;
Populus trichocarpaPotri.002G021200;
Vitis viniferaVV18G10710;

Map Image: 


Login | © 2019 PlantGenIE.org.| All our tools are under MIT License

  • GeneList
      view active genelist () here.
      genelist namegenesrename/delete
      add new genelist / save current list / cancel
  • Analysis
  • <