00       00

Click here to search
Bug Report
Report an error

P.abies 1.0 gene MA_142765g0020
Page views 34


Chromosome Start End Confidence Trinity id Subject length Subject coverage Subject strand Query strand
Loading data from server


Gene Description based on Blast2GO: Hypothetical protein, partial


Map Image: 


Gene Ontology values could not be found for MA_142765g0020 gene.



PFAM ID could not be found for MA_142765g0020 gene.



CDS Sequence
Legend:   CDS        START        STOP                         

>MA_142765g0020[366 nucleotides] 
ATGGTTTGGAGATCATGGACGGGAACAACAAGGACGTCTGGAACAACGGCGCATCGAATAACTACCAGTCATTGGTTCTGCGGGAAAACGGAGCTCTCCAATTGGTGGACAAGAAACGACAGACTGTCTACCGATCATCCGTGGGTGAATCAAAACTGCGGCACCGTTCTCCAGCCAGGATCCTCTCCTTTTATTAATCCTCCATTCGCTTCCCCACTACAGGCTCAACTGCCCAACGGCCAGCCAGTCTTCTTGCATCCTTTCACTACCGCTAATCCCATCGTGGGTAGTGCTCCTCCACAAATAATTCACCCATATTACCAGGCTGCTGCTGGATGTCTCATCGCCATCTTTTTCCATCCTTAG
   



Genomic Sequence (- strand)     upstream:    downstream:   
Legend:   CDS                         

>MA_142765:31929-32294[366 nucleotides] 
ATGGTTTGGAGATCATGGACGGGAACAACAAGGACGTCTGGAACAACGGCGCATCGAATAACTACCAGTCATTGGTTCTGCGGGAAAACGGAGCTCTCCAATTGGTGGACAAGAAACGACAGACTGTCTACCGATCATCCGTGGGTGAATCAAAACTGCGGCACCGTTCTCCAGCCAGGATCCTCTCCTTTTATTAATCCTCCATTCGCTTCCCCACTACAGGCTCAACTGCCCAACGGCCAGCCAGTCTTCTTGCATCCTTTCACTACCGCTAATCCCATCGTGGGTAGTGCTCCTCCACAAATAATTCACCCATATTACCAGGCTGCTGCTGGATGTCTCATCGCCATCTTTTTCCATCCTTAG
   



Peptide Sequence
>MA_142765p0020[121 residues] 
MVWRSWTGTTRTSGTTAHRITTSHWFCGKTELSNWWTRNDRLSTDHPWVNQNCGTVLQPGSSPFINPPFASPLQAQLPNGQPVFLHPFTTANPIVGSAPPQIIHPYYQAAAGCLIAIFFHP*
   



PlantGenIE GeneLists

Gene Family Genes
Amborella trichopodascaffold00041.152;
Picea abiesMA_36566g0010; MA_142765g0010; MA_156299g0030; MA_26909g0010; MA_5831221g0010; MA_156299g0010; MA_25658g0010; MA_9418976g0010; MA_1056310g0010; MA_142765g0020; MA_156299g0020;
Pinus taedaPITA_000010564-RA; PITA_000031311-RA; PITA_000009014-RA; PITA_000095178-RA; PITA_000065039-RA; PITA_000050620-RA; PITA_000050619-RA; PITA_000050621-RA; PITA_000095433-RA;
Populus trichocarpaPotri.002G021200;
Vitis viniferaVV18G10710;

Map Image: 


Login | © 2019 PlantGenIE.org.| All our tools are under MIT License

  • GeneList
      view active genelist () here.
      genelist namegenesrename/delete
      add new genelist / save current list / cancel
  • Analysis
  • <