00       00

Click here to search
Bug Report
Report an error

P.abies 1.0 gene MA_10436315g0020
Page views 51


Chromosome Start End Confidence Trinity id Subject length Subject coverage Subject strand Query strand
Loading data from server


Gene Description based on Blast2GO: AP2 ERF and B3 domain-containing transcription factor RAV1-like

Populus Transcript name:     Potri.008G117100.1
Arabidopsis id:     AT1G13260.1

Map Image: 


Gene Ontology values could not be found for MA_10436315g0020 gene.


PFAM ID Description
PF02362B3 DNA binding domain

CDS Sequence
Legend:   CDS        START                         

>MA_10436315g0020[498 nucleotides] 
ATGACTAACTTCAGTCCGATGGGAGACGATGATCCGGAGGTCCGATTCATGAACGAGCACACCAAGAGAGAAATTGTTGACATGCTCCGAAAGCACACATATGACGAGGAACTGGAACATCATAGCAAGAGGATCAAGATGATAGCAGCACGGTCGGCCGCCATGAACAACGCCGAGGCGTCCGGCCTGGGAGCTGATGTCTGTCAAGAAAGCGAAGGGGTCGTGGACGGAAACGCGAATGCCGCCTCCTCTTCCACCGCCACTGCCGACAGGGGGGGTCTGCCCCGTGAGCACCTTTTCGACAAGGCCGTCACGCCCAGCGACGTGGGCAAATTGAATCGCCTGGTGATTCCGAAGCAGTGCGCAGAGAAATATTTTCCTCTGGACGTCAGTTCCAGCGAGAAGGGTTTGCTCTTGAATTTCGAAGATAACACGGGGAAAGTCTGGCGATTCCGTTACTCGTATTGGAACAGCAGCCAGAGCTACGTGCTGACNNNN
   



Genomic Sequence (- strand)     upstream:    downstream:   
Legend:   CDS                         

>MA_10436315:20370-20867[498 nucleotides] 
ATGACTAACTTCAGTCCGATGGGAGACGATGATCCGGAGGTCCGATTCATGAACGAGCACACCAAGAGAGAAATTGTTGACATGCTCCGAAAGCACACATATGACGAGGAACTGGAACATCATAGCAAGAGGATCAAGATGATAGCAGCACGGTCGGCCGCCATGAACAACGCCGAGGCGTCCGGCCTGGGAGCTGATGTCTGTCAAGAAAGCGAAGGGGTCGTGGACGGAAACGCGAATGCCGCCTCCTCTTCCACCGCCACTGCCGACAGGGGGGGTCTGCCCCGTGAGCACCTTTTCGACAAGGCCGTCACGCCCAGCGACGTGGGCAAATTGAATCGCCTGGTGATTCCGAAGCAGTGCGCAGAGAAATATTTTCCTCTGGACGTCAGTTCCAGCGAGAAGGGTTTGCTCTTGAATTTCGAAGATAACACGGGGAAAGTCTGGCGATTCCGTTACTCGTATTGGAACAGCAGCCAGAGCTACGTGCTGACNNNN
   



Peptide Sequence
>MA_10436315p0020[166 residues] 
MTNFSPMGDDDPEVRFMNEHTKREIVDMLRKHTYDEELEHHSKRIKMIAARSAAMNNAEASGLGADVCQESEGVVDGNANAASSSTATADRGGLPREHLFDKAVTPSDVGKLNRLVIPKQCAEKYFPLDVSSSEKGLLLNFEDNTGKVWRFRYSYWNSSQSYVLTX
   



PlantGenIE GeneLists

Gene Family Genes
Amborella trichopodascaffold00007.249; scaffold00018.9; scaffold00114.66; scaffold00013.54; scaffold00047.127;
Arabidopsis thalianaAT2G36080; AT1G68840; AT1G13260; AT3G25730; AT1G25560; AT1G01030; AT2G46870; AT3G61970; AT5G06250; AT3G11580; AT1G51120; AT1G50680; AT4G01500;
Oryza sativa ssp. japonicaOS02G45850; OS12G06080; OS01G04750; OS06G01860; OS01G49830; OS05G47650; OS01G04800; OS03G02900; OS04G49230; OS10G39190; OS11G05740; OS08G06120; OS02G25830; OS02G25820;
Oryza sativa ssp. japonicaOL14G00370;
Physcomitrella patensPP00063G00420; PP00135G00380;
Picea abiesMA_178646g0010; MA_116574g0010; MA_3834g0010; MA_865117g0010; MA_140243g0010; MA_20372g0020; MA_5748192g0010; MA_961181g0010; MA_84920g0010; MA_106270g0010; MA_5039g0010; MA_18923g0010; MA_23673g0010; MA_19420g0020; MA_17571g0010; MA_70029g0010; MA_292990g0010; MA_10428163g0010; MA_10436315g0020; MA_83356g0010; MA_246350g0010; MA_10436315g0010; MA_3503583g0010; MA_10432625g0010; MA_10433425g0010; MA_94318g0010; MA_83851g0010; MA_6617152g0010; MA_187673g0010; MA_189152g0010; MA_136974g0010; MA_41885g0010; MA_10430690g0010; MA_6373997g0010; MA_15516g0020; MA_58755g0010; MA_161329g0020; MA_953813g0010;
Pinus taedaPITA_000082330-RA; PITA_000011704-RA; PITA_000014154-RA; PITA_000068539-RA; PITA_000004115-RA; PITA_000050615-RA; PITA_000054020-RA; PITA_000039996-RA; PITA_000057888-RA; PITA_000038216-RA; PITA_000095315-RA; PITA_000084987-RA; PITA_000038031-RA; PITA_000033500-RA; PITA_000073596-RA; PITA_000040067-RA; PITA_000006697-RA; PITA_000040012-RA; PITA_000032430-RA; PITA_000056883-RA; PITA_000033801-RA; PITA_000058247-RA; PITA_000075183-RA; PITA_000070161-RA; PITA_000030614-RA; PITA_000023450-RA; PITA_000068075-RA; PITA_000038030-RA; PITA_000029659-RA; PITA_000050554-RA; PITA_000086753-RA; PITA_000047368-RA; PITA_000075575-RA; PITA_000043876-RA; PITA_000014552-RA; PITA_000086571-RA; PITA_000028258-RA; PITA_000056884-RA; PITA_000048427-RA; PITA_000062397-RA; PITA_000089673-RA; PITA_000072410-RA; PITA_000006180-RA; PITA_000047369-RA; PITA_000048428-RA; PITA_000050555-RA;
Populus trichocarpaPotri.010G129200; Potri.008G117100; Potri.014G107200; Potri.011G149700; Potri.002G181600; Potri.001G452200; Potri.006G208100; Potri.016G074500; Potri.018G109200; Potri.003G212800; Potri.006G186300;
Selaginella moellendorffiiSM00039G01420; SM00000G07110; SM00021G01140; SM00021G01120; SM00006G00950;
Vitis viniferaVV15G07630; VV02G06020; VV08G12460; VV01G08180; VV14G15340; VV11G07050;
Zea maysZM10G02100; ZM03G34240; ZM06G30280; ZM08G09840; ZM08G26000; ZM05G10130; ZM01G01410; ZM08G14370; ZM05G36700; ZM02G06440; ZM10G21460; ZM09G20100; ZM01G20040; ZM04G30040; ZM06G06750; ZM10G06600; ZM10G08620; ZM10G10140; ZM04G21240;

Map Image: 


Login | © 2019 PlantGenIE.org.| All our tools are under MIT License

  • GeneList
      view active genelist () here.
      genelist namegenesrename/delete
      add new genelist / save current list / cancel
  • Analysis
  • <