00       00

Click here to search
Bug Report
Report an error

P.abies 1.0 gene MA_250413g0010
Page views 315


Chromosome Start End Confidence Trinity id Subject length Subject coverage Subject strand Query strand
Loading data from server


Gene Description based on Blast2GO: Unknown


Map Image: 


Gene Ontology values could not be found for MA_250413g0010 gene.


PFAM ID Description
PF11493Thylakoid soluble phosphoprotein TSP9

CDS Sequence
Legend:   CDS        START        STOP                         

>MA_250413g0010[300 nucleotides] 
ATGGCGTCGCTGGTGATTGCGCTACCCGTGGGCAACGTTGTGGCCGCCACTTCAAACGTGGCGAAGGGCTCCTCCGAGAAGAAGAAAGGTTTTTTGGACTGGCTGGGAGAGCGACTACAGAGAGAACAATTATTGGAGACCGACCCCATTCTCAGGAAAGGCAACGGCGAGGGCAACGGCAACGCTCGTCCTCCCTCCGGCAGAGTTGCTGCAGGAAAGAAGGGCGGCTCCGCCTCCTCCTCTTCCGAGGACAAGAAATCAGGCGGCGGCCCCTTCGGAGGCCTCTTCGGTAAAAAGTGA
   



Genomic Sequence (+ strand)     upstream:    downstream:   
Legend:   CDS                         

>MA_250413:3144-3443[300 nucleotides] 
ATGGCGTCGCTGGTGATTGCGCTACCCGTGGGCAACGTTGTGGCCGCCACTTCAAACGTGGCGAAGGGCTCCTCCGAGAAGAAGAAAGGTTTTTTGGACTGGCTGGGAGAGCGACTACAGAGAGAACAATTATTGGAGACCGACCCCATTCTCAGGAAAGGCAACGGCGAGGGCAACGGCAACGCTCGTCCTCCCTCCGGCAGAGTTGCTGCAGGAAAGAAGGGCGGCTCCGCCTCCTCCTCTTCCGAGGACAAGAAATCAGGCGGCGGCCCCTTCGGAGGCCTCTTCGGTAAAAAGTGA
   



Peptide Sequence
>MA_250413p0010[99 residues] 
MASLVIALPVGNVVAATSNVAKGSSEKKKGFLDWLGERLQREQLLETDPILRKGNGEGNGNARPPSGRVAAGKKGGSASSSSEDKKSGGGPFGGLFGKK*
   



PlantGenIE GeneLists

Gene Family Genes
Picea abiesMA_250413g0010;
Pinus taedaPITA_000089525-RA;

Map Image: 


Login | © 2019 PlantGenIE.org.| All our tools are under MIT License

  • GeneList
      view active genelist () here.
      genelist namegenesrename/delete
      add new genelist / save current list / cancel
  • Analysis
  • <